Recombinant Human MMP-7 Protein
Produktgrößen
10 ug
£163,00
RP01928-10UG
20 ug
£223,00
RP01928-20UG
50 ug
£336,00
RP01928-50UG
100 ug
£509,00
RP01928-100UG
500 ug
£1478,00
RP01928-500UG
1000 ug
£2335,00
RP01928-1000UG
Über dieses Produkt
- SKU:
- RP01928
- Zusätzliche Namen:
- MMP7, MPSL1, PUMP1,Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase
- Weitere Details:
- MMP-7,Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.Matrix metalloproteinases (MMPs) are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-7 (matrilysin) is expressed in epithelial cells of normal and diseased tissues, and is capable of digesting a large series of proteins of the extracellular matrix including collagen IV and X, gelatin, casein, laminin, aggrecan, entactin, elastin and versican. MMP-7 is implicated in the activation of other proteinases such as plasminogen, MMP-1, MMP-2, and MMP-9. In addition to its roles in connective tissue remodeling and cancer, MMP-7 also regulates intestinal alpha -defensin activation in innate host defense, releases tumor necrosis factor-alpha in a model of herniated disc resorption, and cleaves FasL to generate a soluble form in a model of prostate involution. Structurally, MMP-7 is the smallest of the MMPs and consists of two domains: a pro-domain that is cleaved upon activation and a catalytic domain containing the zinc-binding site.
- Formulierung:
- Recombinant Recombinant Human MMP-7 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Met1-Lys267) of Human MMP-7 (Accession #NP_002414.1) fused with a
- Immunogen:
- Met1-Lys267
- Molekulargewicht:
- 30-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01928