Recombinant Mouse CCL7/MCP-3 Protein
Produktgrößen
10 ug
£145,00
RP01923-10UG
20 ug
£193,00
RP01923-20UG
50 ug
£288,00
RP01923-50UG
100 ug
£431,00
RP01923-100UG
500 ug
£1240,00
RP01923-500UG
1000 ug
£1954,00
RP01923-1000UG
Über dieses Produkt
- SKU:
- RP01923
- Zusätzliche Namen:
- C-C motif chemokine 7|CCL7|chemokine (C-C motif) ligand 7|FIC|MARC|MCP-3|MCP-3Small-inducible cytokine A7|MCP3Monocyte chemotactic protein 3|MGC138465|Monocyte chemoattractant protein 3|NC28SCYA6|SCYA7MGC138463|small inducible cytokine A7 (monocyte chemotactic protein 3)
- Weitere Details:
- Mouse CCL7/MCP-3, a member of the beta subfamily of chemokines, was initially identified as a transcript that is induced in a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen.Mouse MARC/MCP-3 expression has also been detected during murine experimental allergic encephalomyelitis in the spinal cord, and in LPS-stimulated murine WEHI -3 cells and Swiss 3T3 cells where MARC expression is glucocorticoid-attenuated. Except for one amino acid subsititution, mouse MARC is identical to mouse FIC, the product of a growth factor-activated gene. Mouse CCR2, a mouse chemokine receptor, has been shown to bind JE/MCP-1 with high affinity and MARC/MCP-3 with lower affinity.
- Formulierung:
- Recombinant Mouse CCL7/MCP-3 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro97) of Mouse CCL7/MCP-3 (Accession #NP_038682.1) fused with a his
- Immunogen:
- Gln24-Pro97
- Molekulargewicht:
- 15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01923