Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
Produktgrößen
10 ug
£145,00
RP01916-10UG
20 ug
£193,00
RP01916-20UG
50 ug
£288,00
RP01916-50UG
100 ug
£431,00
RP01916-100UG
500 ug
£1240,00
RP01916-500UG
1000 ug
£1954,00
RP01916-1000UG
Über dieses Produkt
- SKU:
- RP01916
- Zusätzliche Namen:
- CD153|CD153 antigen|CD30 antigen ligand|CD30 Ligand|CD30-L|CD30L|CD30LCD30 ligand|CD30LGMGC138144|TNFSF8|tumor necrosis factor (ligand) superfamily, member 8|tumor necrosis factor ligand superfamily member 8
- Weitere Details:
- CD30 Ligand (CD30L)/TNFSF8 is a type II membrane protein belonging to the TNF superfamily. CD30L is expressed on the cell surface of activated T cells, B cells, and monocytes. The protein is also constitutively expressed on granulocytes and medullary thymic epithelial cells. The specific receptor for CD30L is CD30/TNFRSF8, a type I transmembrane glycoprotein belonging to the TNF receptor superfamily. CD30 was originally identified as a cell surface antigen of Hodgkin's and Reed-Sternberg cells using the monoclonal antibody Ki-1. CD30 is also expressed on different non-Hodgkin's lymphomas, virus-infected T and B cells, and on normal T and B cells after activation. Among T cells, CD30 is preferentially expressed on a subset of T cells producing Th2-type cytokines and on CD4+/CD8+ thymocytes that coexpress CD45RO and IL-4 receptor. CD30 ligation by CD30L mediates pleiotropic effects including cell proliferation, activation, differentiation and cell death by apoptosis. CD30 can act as a costimulatory molecule in thymic negative selection and may also play a critical role in the pathophysiology of Hodgkin's disease and other CD30+ lymphomas.
- Formulierung:
- Recombinant Mouse TNFSF8/CD30 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser103-ASP239) of Mouse TNFSF8/CD30 Ligand (Accession #NP_033
- Immunogen:
- Ser103-ASP239
- Molekulargewicht:
- 20-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- 85%
- Sequenz:
- SWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01916