Recombinant Mouse Endoglin/ENG/CD105 Protein
Produktgrößen
10 ug
£145,00
RP01912-10UG
20 ug
£193,00
RP01912-20UG
50 ug
£288,00
RP01912-50UG
500 ug
£1240,00
RP01912-500UG
1000 ug
£1954,00
RP01912-1000UG
Über dieses Produkt
- SKU:
- RP01912
- Zusätzliche Namen:
- Endoglin, Cell surface MJ7/18 antigen, CD105,Eng, Edg
- Weitere Details:
- ENG,Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis .Required for normal structure and integrity of adult vasculature .Regulates the migration of vascular endothelial cells .Required for normal extraembryonic angiogenesis and for embryonic heart development .May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis .May play a role in the binding of endothelial cells to integrins. Acts as a TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors .Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3 .
- Formulierung:
- Recombinant Mouse Endoglin/ENG/CD105 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu27-Gly581) of Mouse ENG (Accession #NP_031958.2) fused wit
- Immunogen:
- Glu27-Gly581
- Molekulargewicht:
- 65-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01912