Recombinant Mouse CCL22/MDC Protein
Produktgrößen
10 ug
£133,00
RP01906-10UG
20 ug
£181,00
RP01906-20UG
50 ug
£240,00
RP01906-50UG
100 ug
£353,00
RP01906-100UG
500 ug
£1002,00
RP01906-500UG
1000 ug
£1574,00
RP01906-1000UG
Über dieses Produkt
- SKU:
- RP01906
- Zusätzliche Namen:
- Ccl22, Abcd1, Scya22,C-C motif chemokine 22, Activated B and dendritic cell-derived, CC chemokine ABCD-1, Small-inducible cytokine A22
- Weitere Details:
- CCL22 may play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Also, it is a chemotactic for monocytes. dendritic cells and natural killer cells. CCL22 is a mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemattractant activity for neutrophils, eosinophils, and resting T-lymphocytes.
- Formulierung:
- Recombinant Mouse CCL22/MDC Protein by Pichia expression system. The target protein is expressed with sequence (Gly25-Ser92) of Mouse CCL22/MDC (Accession #NP_033163.1) fused with a His tag at the C-t
- Immunogen:
- Gly25-Ser92
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01906