Recombinant Mouse CCL17/TARC Protein
Produktgrößen
10 ug
£145,00
RP01905-10UG
20 ug
£193,00
RP01905-20UG
50 ug
£288,00
RP01905-50UG
100 ug
£431,00
RP01905-100UG
500 ug
£1240,00
RP01905-500UG
1000 ug
£1954,00
RP01905-1000UG
Über dieses Produkt
- SKU:
- RP01905
- Zusätzliche Namen:
- Ccl17, Tarc,C-C motif chemokine 17, ABCD-2, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine
- Weitere Details:
- TARC ligand (CCL17) belongs to the CC chemokine family. It is a small cytokine and the gene is located on q arm of chromosome 16, in humans, along with other chemokines. TARC specifically binds to T-cells and interacts with chemokine receptors CCR4 and CCR8. It plays an important role in T cell development in thymus as well as in trafficking and activation of mature T cells.
- Formulierung:
- Recombinant Mouse CCL17/TARC Protein by Pichia expression system. The target protein is expressed with sequence (Ala24-Pro93) of Mouse CCL17/TARC (Accession #NP_035462.2) fused with a His tag at the C
- Immunogen:
- Ala24-Pro93
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01905