Recombinant Mouse CCL11/Eotaxin Protein
Produktgrößen
10 ug
£145,00
RP01904-10UG
20 ug
£193,00
RP01904-20UG
50 ug
£288,00
RP01904-50UG
100 ug
£431,00
RP01904-100UG
500 ug
£1240,00
RP01904-500UG
1000 ug
£1954,00
RP01904-1000UG
Über dieses Produkt
- SKU:
- RP01904
- Zusätzliche Namen:
- Ccl11, Scya11,Eotaxin, C-C motif chemokine 11, Eosinophil chemotactic protein, Small-inducible cytokine A11
- Weitere Details:
- CCL11 is a potent eosinophil chemoattractant that was originally purified from bronchoalveolar lavage fluid of guinea pigs sensitized by aerosol challenge with ovalbumin. Microsequencing of the purified protein revealed the guinea pig CCL11 to be a member of the beta (CC) chemokine family of inflammatory and immunoregulatory cytokines. cDNA clones for guinea pig, mouse and human CCL11 have been isolated. Mouse CCL11 cDNA encodes a 97 amino acid residue precursor protein from which the amino-terminal 23 amino acid residues are cleaved to generate the 74 amino acid residue mature mouse CCL11. At the protein sequence level, mature mouse CCL11 is approximately 60% identical to mature human and guinea pig CCL11. In addition, mouse CCL11 also shows high amino acid sequence identity to members of the MCP family. Mouse CCL11 is chemotactic for eosinophils, but not mononuclear cells or neutrophils. CCL11 mRNA is expressed in a variety of tissues. The expression of CCL11 mRNA is induced in cultured endothelial cells in response to IFN-gamma. In addition, CCL11 mRNA is also induced in response to the transplantation of IL-4-secreting tumor cells.
- Formulierung:
- Recombinant Mouse CCL11/Eotaxin Protein by Pichia expression system. The target protein is expressed with sequence (His24-Pro97) of Mouse CCL11/Eotaxin (Accession #NP_035460.1) fused with a His tag at
- Immunogen:
- His24-Pro97
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01904