Recombinant Human IFN-alpha H2/IFNA14 Protein
Produktgrößen
10 ug
£145,00
RP01897-10UG
20 ug
£193,00
RP01897-20UG
50 ug
£288,00
RP01897-50UG
100 ug
£431,00
RP01897-100UG
500 ug
£1240,00
RP01897-500UG
1000 ug
£1954,00
RP01897-1000UG
Über dieses Produkt
- SKU:
- RP01897
- Zusätzliche Namen:
- Interferon alpha-14, IFN-alpha-14, Interferon alpha-H, LeIF H, Interferon lambda-2-H, IFNA14
- Weitere Details:
- Interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors . Human IFNA2 was originally cloned in the early '80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology . Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. The extracellular domain (ECD) of mature human IFNA14, shares 58% aa sequence identity with mouse IFNA14. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alphasubunit) and IFNAR2 (beta-subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, and IFNA14 has been shown to be a strong inducer of IFN-stimulated genes and anti-viral protection . IFNA14 has been shown to be potent against HIV-1 by upregulating the transcription of two intrinsic restriction factors with well-established anti-HIV-1 activity, MX2 and tetherin.
- Formulierung:
- Recombinant Human IFN-alpha H2/IFNA14 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Asp189) of Human IFN-alpha H2/IFNA14 (Accession #NP_00
- Immunogen:
- Cys24-Asp189
- Molekulargewicht:
- 20-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01897