Recombinant Rat Sonic hedgehog N-product/SHH Protein
Produktgrößen
10 ug
£145,00
RP01896-10UG
20 ug
£193,00
RP01896-20UG
50 ug
£288,00
RP01896-50UG
100 ug
£431,00
RP01896-100UG
500 ug
£1240,00
RP01896-500UG
1000 ug
£1954,00
RP01896-1000UG
Über dieses Produkt
- SKU:
- RP01896
- Zusätzliche Namen:
- Shh, Vhh-1, Sonic hedgehog protein, SHH, 3.1.-.-, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC, Cleaved into: Sonic hedgehog protein N-product, ShhN, Shh N-terminal processed signaling domains, ShhNp
- Weitere Details:
- Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal . Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene . Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo . A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma .
- Formulierung:
- Recombinant Rat Sonic hedgehog N-product/SHH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gly198) of Rat Sonic hedgehog /SHH (Accession #
- Immunogen:
- Ala24-Gly198
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- ACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01896