Recombinant Mouse CCL21/6Ckine Protein
Produktgrößen
10 ug
£145,00
RP01885-10UG
20 ug
£193,00
RP01885-20UG
50 ug
£288,00
RP01885-50UG
100 ug
£431,00
RP01885-100UG
500 ug
£1240,00
RP01885-500UG
1000 ug
£1954,00
RP01885-1000UG
Über dieses Produkt
- SKU:
- RP01885
- Zusätzliche Namen:
- 6Ckine|Beta-Chemokine Exodus-2|C-C Motif Chemokine 21a|Ccl21a|Scya21|Scya21a|Small-Inducible Cytokine A21a|TCA4|Thymus-Derived Chemotactic Agent 4
- Weitere Details:
- C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CCchemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signalpeptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms whileCCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 andCXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro forthymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 showspreferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes tosecondary lymphoid organs.
- Formulierung:
- Recombinant Mouse CCL21A Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Gly133) of Mouse CCL21A (Accession #P84444) fused with a His tag at the C
- Immunogen:
- Ser24-Gly133
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01885