Recombinant Mouse EREG Protein
Produktgrößen
10 ug
£133,00
RP01880-10UG
20 ug
£181,00
RP01880-20UG
50 ug
£240,00
RP01880-50UG
100 ug
£353,00
RP01880-100UG
500 ug
£1002,00
RP01880-500UG
1000 ug
£1574,00
RP01880-1000UG
Über dieses Produkt
- SKU:
- RP01880
- Zusätzliche Namen:
- Proepiregulin, Cleaved into: Epiregulin, EPR, Ereg
- Weitere Details:
- Epiregulin (EREG) is a member of the epidermal growth factor family. Epiregulin (EREG) can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. Epiregulin (EREG) exhibit bifunctional regulatory properties: it inhibit the growth of several epithelial tumor cells and stimulated the growth of fibroblasts and various other types of cells. Epiregulin (EREG) bound to the EGF receptors of epidermoid carcinoma A431 cells much more weakly than did EGF, but was nevertheless much more potent than EGF as a mitogen for rat primary hepatocytes and Balb/c 3T3 A31 fibroblasts. These findings suggest that epiregulin (EREG) plays important roles in regulating the growth of epithelial cells and fibroblasts by binding to receptors for EGF-related ligands. Epiregulin (EREG) is the broadest specificity EGF-like ligand so far characterized: not only does it stimulate homodimers of both ErbB-1 and ErbB-4, it also activates all possible heterodimeric ErbB complexes.
- Formulierung:
- Recombinant Mouse EREG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val56-Leu101 ) of Mouse EREG (Accession #NP_031976.1) fused with hFc tag at
- Immunogen:
- Val56-Leu101
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01880