Recombinant Human C1QC Protein
Produktgrößen
20 ug
£181,00
RP01865-20UG
100 ug
£353,00
RP01865-100UG
500 ug
£1002,00
RP01865-500UG
1000 ug
£1574,00
RP01865-1000UG
Über dieses Produkt
- SKU:
- RP01865
- Zusätzliche Namen:
- C1Q-C|C1QD3|C1QG|Complement C1q subcomponent subunit C
- Weitere Details:
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
- Formulierung:
- Recombinant HumanC1QC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn29-Asp245) of human ENPP-1 (Accession #P02747) fused with 6xHis and hFc t
- Immunogen:
- Asn29-Asp245
- Molekulargewicht:
- 45-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- NTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01865