Recombinant Human CCL3/MIP-1 alpha Protein
Produktgrößen
10 ug
£145,00
RP01855-10UG
20 ug
£193,00
RP01855-20UG
50 ug
£288,00
RP01855-50UG
100 ug
£431,00
RP01855-100UG
500 ug
£1240,00
RP01855-500UG
1000 ug
£1954,00
RP01855-1000UG
Über dieses Produkt
- SKU:
- RP01855
- Zusätzliche Namen:
- CCL3, G0S19-1, MIP1A, SCYA3,C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein, Cleaved into: MIP-1-alpha(4-69), LD78-alpha(4-69)
- Weitere Details:
- CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It's known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases.
- Formulierung:
- Recombinant Human CCL3/MIP-1 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ala92 ) of Human CCL3/MIP-1 alpha (Accession #NP_002974.1) fus
- Immunogen:
- Ala23-Ala92
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01855