Recombinant Mouse FGF-10 Protein
Produktgrößen
10 ug
£163,00
RP01848-10UG
20 ug
£223,00
RP01848-20UG
50 ug
£336,00
RP01848-50UG
100 ug
£508,00
RP01848-100UG
500 ug
£1478,00
RP01848-500UG
1000 ug
£2335,00
RP01848-1000UG
Über dieses Produkt
- SKU:
- RP01848
- Zusätzliche Namen:
- Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,Fgf10
- Weitere Details:
- Fibroblast Growth Factor 10 (FGF 10) is an evolutionary conserved secreted growth factor mediating mostly mesenchymal to epithelial signaling. FGF 10 belongs to the FGF 7 subfamily and shares similar biochemical and amino acid sequences with its constituent members (FGF3, FGF 7 and FGF 22). As a paracrine FGF, FGF 10 elicits its biological responses by activating the fibroblast growth factor receptor 2b (FGF R 2b), is crucial for governing proximal distal outgrowth as well as patterning and acts upstream of the known apical ectodermal ridge (AER) marker FGF 8. FGF10 is also implicated in pancreatic cancer, and that overexpression of FGFR2b is associated with metastatic invasion.
- Formulierung:
- Recombinant Mouse FGF-10 Protein is produced by E. coli expression systerm. The target protein is expressed with sequence (Gln37-Thr209) of Mouse FGF-10 (Accession #NP_032028.1) fused with no tag.
- Immunogen:
- Gln37-Thr209
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01848