Recombinant Mouse TGF-alpha Protein
Produktgrößen
10 ug
£145,00
RP01846-10UG
20 ug
£193,00
RP01846-20UG
500 ug
£1240,00
RP01846-500UG
1000 ug
£1954,00
RP01846-1000UG
Über dieses Produkt
- SKU:
- RP01846
- Zusätzliche Namen:
- Protransforming growth factor alpha, Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1, Tgfa
- Weitere Details:
- Transforming growth factor alpha (TGF-A Alpha) is a protein that in humans is encoded by the TGFA gene. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes, and macrophages.TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
- Formulierung:
- Recombinant Mouse TGF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala38-Ala88) of Mouse TGF-alpha/TGFA (Accession #NP_112476.1) fused wi
- Immunogen:
- Ala38-Ala88
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- 85%
- Sequenz:
- SPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01846