Recombinant Rat Oncostatin-M/OSM Protein
Produktgrößen
10 ug
£163,00
RP01844-10UG
20 ug
£223,00
RP01844-20UG
50 ug
£336,00
RP01844-50UG
100 ug
£508,00
RP01844-100UG
500 ug
£1478,00
RP01844-500UG
1000 ug
£2335,00
RP01844-1000UG
Über dieses Produkt
- SKU:
- RP01844
- Zusätzliche Namen:
- Oncostatin-M, OSM
- Weitere Details:
- Oncostatin M is also known as OSM, is a glycoprotein belonging to the interleukin-6 family of cytokines that has functions mainly in cell growth. Of these cytokines it most closely resembles leukemia inhibitory factor (LIF) in both structure and function. However, it is as yet poorly defined and is proving important in liver development, haematopoeisis, inflammation and possibly CNS development. It is also associated with bone formation and destruction. OSM signals through cell surface receptors that contain the protein gp130. The type I receptor is composed of gp130 and LIFR, the type II receptor is composed of gp130 and OSMR. Oncostatin M (OSM) was previoustly identified by its ability to inhibit the growth of cells from melanoma and other solid tumors. It also has been reported that OSM, like LIF, IL-6 and G-CSF, has the ability to inhibit the proliferation of murine M1 myeloid leukemic cells and can induce their differentiation into macrophage-like cells.
- Formulierung:
- Recombinant Rat Oncostatin-M/OSM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys26-Arg208) ofRat Oncostatin-M/OSM (Accession #NP_001006962.1)
- Immunogen:
- Lys26-Arg208
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01844