Recombinant Human MUC-16/CA125 Protein
Produktgrößen
10 ug
£127,00
RP01839-10UG
20 ug
£157,00
RP01839-20UG
50 ug
£223,00
RP01839-50UG
100 ug
£336,00
RP01839-100UG
500 ug
£907,00
RP01839-500UG
1000 ug
£1478,00
RP01839-1000UG
Über dieses Produkt
- SKU:
- RP01839
- Zusätzliche Namen:
- Mucin-16, MUC-16, Ovarian cancer-related tumor marker CA125, CA-125, Ovarian carcinoma antigen CA125, MUC16, CA125
- Weitere Details:
- The CA125, also known as the MUC16, is a mucin protein that may be found in type I transmembrane or secreted forms that are used monitor the progress of epithelial ovarian cancer therapy. The CA 125 molecule is almost certainly a glycoprotein with a predominance of O-linkages. It is heterogeneous with regard to both size and charge, most likely due to continuous deglycosylation of side chains during its life-span in bodily fluids. It exists as a very large complex (perhaps as much as 4 million daltons) under natural conditions.
- Formulierung:
- Recombinant Human MUC-16/CA125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly12660-Met12923) of Human MUC-16/CA125 (Accession #NP_078966.2) f
- Immunogen:
- Gly12660-Met12923
- Molekulargewicht:
- 70-90 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01839