Recombinant Human CCL19/MIP-3 beta Protein
Produktgrößen
10 ug
£193,00
RP01832-10UG
20 ug
£258,00
RP01832-20UG
50 ug
£383,00
RP01832-50UG
100 ug
£586,00
RP01832-100UG
500 ug
£1716,00
RP01832-500UG
1000 ug
£2716,00
RP01832-1000UG
Über dieses Produkt
- SKU:
- RP01832
- Zusätzliche Namen:
- CCL19|CKb11|ELC|MIP-3 beta|MIP-3b|MIP3B|SCYA19
- Weitere Details:
- C-C motif chemokine 19(CCL19) is as known as CK beta-11, ELC, MIP3B and SCYA19. May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
- Formulierung:
- Recombinant Human CCL19/MIP-3 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly22-Ser98) of human CCL19/MIP-3 beta (Accession #NP_006265.1)
- Immunogen:
- Gly22-Ser98
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01832