Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein
Produktgrößen
10 ug
£133,00
RP01831-10UG
20 ug
£181,00
RP01831-20UG
50 ug
£240,00
RP01831-50UG
100 ug
£353,00
RP01831-100UG
500 ug
£1002,00
RP01831-500UG
1000 ug
£1574,00
RP01831-1000UG
Über dieses Produkt
- SKU:
- RP01831
- Zusätzliche Namen:
- ANG-5|Angiopoietin-like 3|ANGPT5|ANGPTL3|ANL3|FHBL2
- Weitere Details:
- ANGPTL3 is a secreted glycoprotein that is structurally related to the angiopoietins. Mature human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. ANGPTL3 is expressed in the liver from early in development through adulthood. Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism. Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake.
- Formulierung:
- Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val237-Glu460) of human Angiopoietin-like 3
- Immunogen:
- Val237-Glu460
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01831