Recombinant Mouse CD200R1 Protein
Produktgrößen
10 ug
£133,00
RP01826-10UG
20 ug
£181,00
RP01826-20UG
50 ug
£240,00
RP01826-50UG
100 ug
£353,00
RP01826-100UG
500 ug
£1002,00
RP01826-500UG
1000 ug
£1574,00
RP01826-1000UG
Über dieses Produkt
- SKU:
- RP01826
- Zusätzliche Namen:
- CD200R|CD200R1|Mox2r|OX2R
- Weitere Details:
- The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cell surface glycoprotein CD200 receptor 1 (CD200R1) is an isoform of CD200 receptors that is expressed on cells of the myeloid lineage. CD200R1 is a receptor for the OX-2 membrane glycoprotein. The receptor-substrate interaction may serve as a myeloid downregulatory signal.
- Formulierung:
- Recombinant Mouse CD200R1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr26-Pro238) of mouse CD200R1 (Accession #NP_067300.1) fused with a 6xH
- Immunogen:
- Thr26-Pro238
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01826