Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
Produktgrößen
10 ug
£133,00
RP01825-10UG
20 ug
£181,00
RP01825-20UG
100 ug
£353,00
RP01825-100UG
500 ug
£1002,00
RP01825-500UG
1000 ug
£1574,00
RP01825-1000UG
Über dieses Produkt
- SKU:
- RP01825
- Zusätzliche Namen:
- ARIA|GGF|GGF2|HGL|HRG|HRG1|HRGA|MST131|MSTP131|NDF|NRG1-IT2|NRG1 (Beta1) |Pro-neuregulin-1|SMDF
- Weitere Details:
- neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes thatencode a large number of secreted or membrane-bound isoforms. All family members share an EGF-likedomain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified intotype I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors,concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylationand activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns andplay important roles during development of both the nervous system and the heart.
- Formulierung:
- Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr 176-Lys 246) of human Pro-neuregulin-1/NRG1 (Beta1
- Immunogen:
- Thr 176-Lys 246
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01825