Recombinant Mouse GITR Ligand/TNFSF18 Protein
Produktgrößen
10 ug
£133,00
RP01824-10UG
20 ug
£181,00
RP01824-20UG
50 ug
£240,00
RP01824-50UG
100 ug
£353,00
RP01824-100UG
500 ug
£1002,00
RP01824-500UG
1000 ug
£1574,00
RP01824-1000UG
Über dieses Produkt
- SKU:
- RP01824
- Zusätzliche Namen:
- GITR Ligand|Gitrl|TNFSF18|Tnlg2a
- Weitere Details:
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
- Formulierung:
- Recombinant Mouse GITR Ligand/TNFSF18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr47-Ser173) of mouse GITR Ligand/TNFSF18 (Accession #NP_89
- Immunogen:
- Thr47-Ser173
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01824