Recombinant Human FSH Beta Protein
Produktgrößen
10 ug
£163,00
RP01821-10UG
20 ug
£223,00
RP01821-20UG
50 ug
£336,00
RP01821-50UG
100 ug
£508,00
RP01821-100UG
500 ug
£1478,00
RP01821-500UG
1000 ug
£2335,00
RP01821-1000UG
Über dieses Produkt
- SKU:
- RP01821
- Zusätzliche Namen:
- FSH Beta|FSHB|HH24
- Weitere Details:
- Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
- Formulierung:
- Recombinant Human FSH Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Glu129) of human FSH Beta (Accession #NP_000501.1) fused with a 6
- Immunogen:
- Asn19-Glu129
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01821