Recombinant Human Neurogranin/NRGN Protein
Produktgrößen
10 ug
£133,00
RP01814-10UG
20 ug
£181,00
RP01814-20UG
50 ug
£240,00
RP01814-50UG
100 ug
£353,00
RP01814-100UG
500 ug
£1002,00
RP01814-500UG
1000 ug
£1574,00
RP01814-1000UG
Über dieses Produkt
- SKU:
- RP01814
- Zusätzliche Namen:
- hng|Neurogranin|NRGN|RC3
- Weitere Details:
- Neurogranin is as a small protein encoded by the NRGN gene. it is a calmodulin-binding protein expressed primarily in the brain, particularly in dendritic spines, and participating in the protein kinase C signaling pathway. Neurogranin is the main postsynaptic protein regulating the availability of calmodulin, binding to it in the absence of calcium. Phosphorylation by protein kinase C lowers its binding ability. It is a potential biomarker of neurological and mental diseases.
- Formulierung:
- Recombinant Human Neurogranin/NRGN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp2-Asp78) of human NRGN/Neurogranin (Accession #) fused with
- Immunogen:
- Asp2-Asp78
- Molekulargewicht:
- 45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:RP01814