Recombinant Human Chemerin/RARRES2 Protein
Produktgrößen
10 ug
£133,00
RP01808-10UG
20 ug
£181,00
RP01808-20UG
50 ug
£240,00
RP01808-50UG
100 ug
£353,00
RP01808-100UG
500 ug
£1002,00
RP01808-500UG
1000 ug
£1574,00
RP01808-1000UG
Über dieses Produkt
- SKU:
- RP01808
- Zusätzliche Namen:
- HP10433|RARRES2|TIG2
- Weitere Details:
- Retinoic acid receptor responder protein 2 (RARRES2) is a small secreted protein involved in multiple cancers, including adrenocortical carcinoma (ACC). Serum RARRES2 may be used as a novel prognostic marker for ACC. Retinoic acid receptor responder 2 (RARRES2) is transcriptionally downregulated in multiple cancer types. Previous studies suggested that it can serve as an immune-dependent tumor suppressor by acting as a chemoattractant to recruit anticancer immune cells expressing its receptor, the chemerin chemokine receptor 1 (CMKLR1), to sites of tumor. Mechanistically, RARRES2 overexpression in ACC cells inhibited Wnt/beta-catenin pathway activity by promoting beta-catenin phosphorylation and degradation, it also inhibited the phosphorylation of p38 mitogen-activated protein kinase. Thus RARRES2 is a novel tumor suppressor for ACC, which can function through an immune-independent mechanism.
- Formulierung:
- Recombinant Human Chemerin/RARRES2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Ser157) of human RARRES2/TIG2 (Accession #) fused with hF
- Immunogen:
- Glu21-Ser157
- Molekulargewicht:
- 45-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01808