Recombinant Mouse ALK-4/ACVR1B Protein
Produktgrößen
10 ug
£127,00
RP01803-10UG
20 ug
£175,00
RP01803-20UG
50 ug
£240,00
RP01803-50UG
100 ug
£336,00
RP01803-100UG
500 ug
£1002,00
RP01803-500UG
1000 ug
£1574,00
RP01803-1000UG
Über dieses Produkt
- SKU:
- RP01803
- Zusätzliche Namen:
- 6820432J04|ActR-IB|ActRIB|Acvrlk4|ALK-4|Alk4|SKR2
- Weitere Details:
- ACVR1B (Activin A Receptor, type 1B), belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, and TGFB receptor subfamily. ALK-4/ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B. The known type II activin receptors include ActRII and ActRIIB, while the main type I activin receptor in mammalian cells is ALK-4 (ActRIB). In the presence of activin, type II and type I receptors form complexes whereby the type II receptors activate ALK-4 through phosphorylation. The activated ALK-4, in turn, transduces signals downstream by phosphorylation of its effectors, such as Smads, to regulate gene expression and affect cellular phenotype. ALK-4/ACVR1B is an important regulator of vertebrate development, with roles in mesoderm induction, primitive streak formation, gastrulation, dorsoanterior patterning, and left-right axis determination.
- Formulierung:
- Recombinant Mouse ALK-4/ACVR1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu126) of mouse ALK-4/ACVR1B (Accession #NP_031421.1) fused w
- Immunogen:
- Met1-Glu126
- Molekulargewicht:
- 45-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01803