Recombinant Rat IL-1 beta Protein
Produktgrößen
10 ug
£145,00
RP01788-10UG
20 ug
£193,00
RP01788-20UG
50 ul
£288,00
RP01788-50UL
100 ul
£431,00
RP01788-100UL
500 ug
£1240,00
RP01788-500UG
1000 ug
£1954,00
RP01788-1000UG
Über dieses Produkt
- SKU:
- RP01788
- Zusätzliche Namen:
- IL-1 beta,IL1B,IL-1BETA,IL1F2,IL-1B Beta,il1b,IL1B|IL-1F2
- Weitere Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Formulierung:
- Recombinant Rat IL-1 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val117-Ser268) of rat IL-1 beta (Accession #NP_113700.2) fused with a 6x
- Immunogen:
- Val117-Ser268
- Molekulargewicht:
- 18-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01788