Recombinant Human TNFSF13/APRIL/CD256 Protein
Produktgrößen
10 ug
£145,00
RP01777-10UG
20 ug
£193,00
RP01777-20UG
50 ug
£288,00
RP01777-50UG
100 ug
£431,00
RP01777-100UG
500 ug
£1240,00
RP01777-500UG
1000 ug
£1954,00
RP01777-1000UG
Über dieses Produkt
- SKU:
- RP01777
- Zusätzliche Namen:
- APRIL|CD256|TALL-2|TALL2|TNFSF13|TNLG7B|TRDL-1|UNQ383/PRO715|ZTNF2
- Weitere Details:
- TNFSF13 is a member of the tumor necrosis factor (TNF) ligand family. It is a ligand for TNFRSF17/BCMA. TNFSF13 is lowly expressed in normal tissues, but is elevated in several types of tumors and transformed cell lines. It is important for B cell development. TNFSF13 may also play a role in T-independent type II antigen responses and T cell survival, and induce proliferation/survival of non lymphoid cells. It exists as a functional homotrimer. It can bind to two cell surface receptors, BCMA and TACI, which it shares with BAFF to exert downstream T- and B-cell regulatory effects. TNFSF13 also has been demonstrated to bind to proteoglycans on the cell surface.
- Formulierung:
- Recombinant Human TNFSF13/APRIL/CD256 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys111-leu250) of human TNFSF13 (Accession #NP_001185552.1)
- Immunogen:
- Lys111-leu250
- Molekulargewicht:
- 50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- KQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01777