Recombinant Human CXCL4/PF-4 Protein
Produktgrößen
10 ug
£145,00
RP01774-10UG
20 ug
£193,00
RP01774-20UG
50 ug
£336,00
RP01774-50UG
500 ug
£1240,00
RP01774-500UG
1000 ug
£1954,00
RP01774-1000UG
Über dieses Produkt
- SKU:
- RP01774
- Zusätzliche Namen:
- CXCL4|PF-4|SCYB4
- Weitere Details:
- CXCL4, or Platelet factor 4 (PF4), is a small cytokine belonging to the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. CXCL4 is chemotactic for neutrophils and monocytes and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. CXCL4/PF4 is up-regulated in human liver fibrosis and that it plays a nonredundant, functional role in experimental liver fibrosis by mediating stellate cell proliferation, migration, and intrahepatic immune cell recruitment.
- Formulierung:
- Recombinant Human CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu32-Ser101) of human PF-4/CXCL4/SCYB4 (Accession #NP_002610.1) fuse
- Immunogen:
- Glu32-Ser101
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01774