Recombinant Human MMP-7 Protein
Produktgrößen
10 ug
£163,00
RP01770LQ-10UG
20 ug
£223,00
RP01770LQ-20UG
50 ug
£336,00
RP01770LQ-50UG
100 ug
£508,00
RP01770LQ-100UG
500 ug
£1503,00
RP01770LQ-500UG
1000 ug
£2360,00
RP01770LQ-1000UG
Über dieses Produkt
- SKU:
- RP01770LQ
- Zusätzliche Namen:
- MMP7, MPSL1, PUMP1,Matrilysin, Matrix metalloproteinase-7, MMP-7
- Weitere Details:
- Matrix metalloproteinase-7 (MMP-7) also known as neutrophil collagenase and CLG1, is a member of matrix metalloproteinases (MMPs) family, which degrade components of the extracellular matrix (ECM) and play essential roles in various physiological processes as well as pathological processes. MMP-7 may affect the metastatic behavior of breast cancer cells through protection against lymph node metastasis, underlining the importance of anti-target identification in drug development. MMP-7 in the tumor may have a protective effect against lymph node metastasis.
- Formulierung:
- Recombinant Human MMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr97-Lys267) of human MMP7 (Accession #NP_002414.1) fused with hFc tag at
- Immunogen:
- Tyr95-Lys267
- Molekulargewicht:
- 35-40 kDa
- Reinheit:
- ≥95%
- Sequenz:
- YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01770LQ