Recombinant Mouse IL-36 gamma/IL-1F9 Protein
Produktgrößen
10 ug
£163,00
RP01762-10UG
20 ug
£223,00
RP01762-20UG
50 ug
£336,00
RP01762-50UG
100 ug
£508,00
RP01762-100UG
500 ug
£1478,00
RP01762-500UG
1000 ug
£2335,00
RP01762-1000UG
Über dieses Produkt
- SKU:
- RP01762
- Zusätzliche Namen:
- If36g|IL-36gamma|Il1f9
- Weitere Details:
- The protein is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.
- Formulierung:
- Recombinant Mouse IL-36 gamma/IL-1F9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly13-Ser164) of mouse IL36G (Accession #) fused with and a 6
- Immunogen:
- Gly13-Ser164
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01762
