Recombinant Human HHG-3/DHH Protein
Produktgrößen
10 ug
£133,00
RP01758-10UG
20 ug
£181,00
RP01758-20UG
50 ug
£240,00
RP01758-50UG
100 ug
£353,00
RP01758-100UG
500 ug
£1002,00
RP01758-500UG
1000 ug
£1574,00
RP01758-1000UG
Über dieses Produkt
- SKU:
- RP01758
- Zusätzliche Namen:
- DHH|GDMN|GDXYM|HHG-3|SRXY7
- Weitere Details:
- Desert Hedgehog (Dhh) belongs to the highly conserved Hedgehog family of proteins which are involved in multiple developmental processes. Desert Hedgehog is a secreted, 45 kDa, 373 amino acid (aa) protein that undergoes autocatalytic cleavage between Gly198 and Cys199 catalyzed by the C-terminal domain, which releases the N-terminal domain with a concominant attachment of cholesterol at its new C-terminus. In addition to the C-terminally attached cholesterol, a fatty acid acyl chain is esterified to the N-terminal cysteine (aa 23) via an amide linkage. The 19 kDa N-terminal signaling domain is membrane associated due to its double lipid modifications. Its binding to Patched receptors results in the loss of Patched repression of Smoothened signaling (1 - 4). Dhh binds both Patched and Patched 2 as well as Hedgehog interacting protein (Hip) (5). Within the N-terminal domain, human Dhh shares 97% aa sequence identity with mouse and rat Dhh. It shares approximately 75% aa seqeuence identity with human Indian (Ihh) and Sonic Hedgehog (Shh) (5). Dhh is produced by Sertoli cells and is required for testis development and spermatogenesis (6, 7). It induces steroidogenic factor 1, which is instrumental in promoting Leydig cell differentiation (8, 9).
- Formulierung:
- Recombinant Human HHG-3/DHH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys23-Gly198) of human HHG-3/DHH (Accession #NP_066382.1) fused with a 6xHi
- Immunogen:
- Cys23-Gly198
- Molekulargewicht:
- 24-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- CGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01758