Recombinant Human Interferon omega-1/IFNW1 Protein
Produktgrößen
10 ug
£127,00
RP01752-10UG
20 ug
£175,00
RP01752-20UG
50 ug
£240,00
RP01752-50UG
100 ug
£336,00
RP01752-100UG
500 ug
£1002,00
RP01752-500UG
1000 ug
£1574,00
RP01752-1000UG
Über dieses Produkt
- SKU:
- RP01752
- Zusätzliche Namen:
- Interferon omega-1; IFNW1
- Weitere Details:
- IFNs are a large family of proteins having antiviral, antiproliferative, and immunomodulatory effects, and are divided into two major classes, type I and type II, based on differences in receptor binding and nucleotide sequence. Type I IFNs consist of IFN A Alpha, B Beta, T Tau, and W Omega and bind to the type I IFN receptor, whereas IFN-G Gamma is the only type II IFN and is specific for the type II IFN receptor. Human IFN-W Omega, was identified by three independent groups in 1985 and is structurally related to IFN-A Alpha and -B Beta. Both human IFN-W Omega and IFN-A Alpha are produced by virally induced leukocytes and have similar antiviral activities on human cell lines, and a sizeable proportion (at least 1%) of the total antiviral activity of leukocyte IFN is contributed by IFN-W Omegal. Also, it was reported that IFN-W Omega could inhibit the growth of human tumors in vivo.
- Formulierung:
- Recombinant Human Interferon omega-1/IFNW1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser195) of human Interferon omega-1/IFNW1 (Access
- Immunogen:
- Gly23-Ser195
- Molekulargewicht:
- 25-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01752
