Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein
Produktgrößen
10 ug
£145,00
RP01746-10UG
20 ug
£193,00
RP01746-20UG
50 ug
£288,00
RP01746-50UG
100 ug
£431,00
RP01746-100UG
500 ug
£1240,00
RP01746-500UG
1000 ug
£1954,00
RP01746-1000UG
Über dieses Produkt
- SKU:
- RP01746
- Zusätzliche Namen:
- CS-1|CSA|CSMT|GHB3|hCS-1|hCS-A|PL
- Weitere Details:
- Chorionic somatomammotropin hormone, also known as Choriomammotropin, Lactogen, Placental lactogen and CSH1, is a secreted protein which belongs to thesomatotropin / prolactin family. CSH1 is produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. The CSH1 gene is member of the GH gene cluster on 17q, which consists of two growth hormone genes and three CSH genes. Genomic alterations in the GH cluster are well known, causing different phenotypes depending on the size of the deletion and the genes involved. The increased prevalence of hemizygosity of CSH1 in population in comparison to controls indicates a role for CSH1 haploinsufficiency in the etiology of growth retardation. Investigation of CSH1 deletions in further SRS and growth retarded patients will enable us to establish under which circumstances haploinsufficiency of CSH1 is likely to result in clinical changes.
- Formulierung:
- Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val27-Phe217) of hu
- Immunogen:
- Val27-Phe217
- Molekulargewicht:
- 25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:RP01746