Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein
Produktgrößen
10 ug
£145,00
RP01744-10UG
20 ug
£193,00
RP01744-20UG
50 ug
£288,00
RP01744-50UG
100 ug
£431,00
RP01744-100UG
500 ug
£1240,00
RP01744-500UG
1000 ug
£1954,00
RP01744-1000UG
Über dieses Produkt
- SKU:
- RP01744
- Zusätzliche Namen:
- Agpt2|Ang-2|Ang2
- Weitere Details:
- Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization
- Formulierung:
- Recombinant Mouse Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys275-Phe496) of mouse Angiopoietin-2/ANG-
- Immunogen:
- Lys275-Phe496
- Molekulargewicht:
- 35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01744