Recombinant human FGF-23 Protein
Produktgrößen
10 ug
£193,00
RP01740-10UG
20 ug
£288,00
RP01740-20UG
50 ug
£431,00
RP01740-50UG
500 ug
£1954,00
RP01740-500UG
1000 ug
£3097,00
RP01740-1000UG
Über dieses Produkt
- SKU:
- RP01740
- Zusätzliche Namen:
- ADHR|FGFN|HFTC2|HPDR2|HYPF|PHPTC
- Weitere Details:
- Fibroblast growth factor 23 (FGF23) is is an endocrine member of the family of FGFs and mainly produced in the bone and, upon secretion, forms a complex with a FGF receptor and coreceptor A AlphaKlotho. FGF23 can exert several endocrine functions, such as acting as a hormone on the kidney, stimulating phosphate excretion and suppressing formation of 1,25(OH)2D3, active vitamin D. Moreover, it has paracrine activities on several cell types, including neutrophils and hepatocytes. FGF23 and phosphate have been revealed to be factors relevant in cancer. FGF23 is particularly significant for those forms of cancer primarily affecting bone (e.g., multiple myeloma) or characterized by bone metastasis.
- Formulierung:
- Recombinant human FGF-23 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr25-Ile251) of human FGF-23/Fibroblast growth factor 23 (Accession #NP_
- Immunogen:
- Tyr25-Ile251
- Molekulargewicht:
- 35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01740