Recombinant Rat IFN-gamma Protein
Produktgrößen
10 ug
£145,00
RP01739-10UG
20 ug
£193,00
RP01739-20UG
50 ug
£288,00
RP01739-50UG
100 ug
£431,00
RP01739-100UG
500 ug
£1240,00
RP01739-500UG
1000 ug
£1954,00
RP01739-1000UG
Über dieses Produkt
- SKU:
- RP01739
- Zusätzliche Namen:
- If2f|IFNG2; IFNG; IFN-gamma
- Weitere Details:
- Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
- Formulierung:
- Recombinant Rat IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Cys156) of rat IFN-gamma (Accession #NP_620235.1) fused with and a
- Immunogen:
- Gln23-Cys156
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- 85%
- Sequenz:
- QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01739