Recombinant Rat IL-1 alpha Protein
Produktgrößen
10 ug
£163,00
RP01736-10UG
20 ug
£223,00
RP01736-20UG
50 ug
£336,00
RP01736-50UG
100 ug
£508,00
RP01736-100UG
500 ug
£1478,00
RP01736-500UG
1000 ug
£2335,00
RP01736-1000UG
Über dieses Produkt
- SKU:
- RP01736
- Zusätzliche Namen:
- IL-1 alpha|IL-1F1|IL-1A Alpha
- Weitere Details:
- IL-1 alpha is a member of the interleukin 1 cytokine family. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems.IL-1 alpha is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. It is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity.
- Formulierung:
- Recombinant Rat IL-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser115-Ser270) of rat IL-1 alpha/Il1a (Accession #) fused with and a 6x
- Immunogen:
- Ser115-Ser270
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01736