Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein
Produktgrößen
10 ug
£145,00
RP01734-10UG
20 ug
£193,00
RP01734-20UG
50 ug
£288,00
RP01734-50UG
100 ug
£431,00
RP01734-100UG
500 ug
£1240,00
RP01734-500UG
1000 ug
£1954,00
RP01734-1000UG
Über dieses Produkt
- SKU:
- RP01734
- Zusätzliche Namen:
- CD154|CD40-L|Cd40l|CD40LG|gp39|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|Tnfsf5|Tnlg8b|TRAP
- Weitere Details:
- CD154, also known as CD40 ligand or CD40L, is a member of the TNF superfamily. While CD154 was originally found on T cell surface, its expression has since been found on a wide variety of cells, including platelets, mast cells, macrophages and NK cells. CD154's ability is achieved through binding to the CD40 on antigen-presenting cells (APC). In the macrophage cells, the primary signal for activation is IFN-G Gamma from Th1 type CD4 T cells. The secondary signal is CD40L on the T cell, which interacting with the CD40 molecules, helping increase the level of activation.
- Formulierung:
- Recombinant Mouse TNFSF5/CD40 ligand/CD154 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly115-Leu260) of mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG
- Immunogen:
- Gly115-Leu260
- Molekulargewicht:
- 19-22 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01734
