Recombinant Rat IL-7 Protein
Produktgrößen
10 ug
£145,00
RP01721-10UG
20 ug
£193,00
RP01721-20UG
50 ug
£288,00
RP01721-50UG
100 ug
£431,00
RP01721-100UG
500 ug
£1240,00
RP01721-500UG
1000 ug
£1954,00
RP01721-1000UG
Über dieses Produkt
- SKU:
- RP01721
- Zusätzliche Namen:
- IL-7,Interleukin-7; IL7
- Weitere Details:
- IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.
- Formulierung:
- Recombinant Rat IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-Ile154) of rat IL-7 (Accession #NP_037242.2) fused with and a 6xHis tag
- Immunogen:
- Asp26-Ile154
- Molekulargewicht:
- 15-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01721

