Recombinant Mouse FGF-21 Protein
Produktgrößen
10 ug
£133,00
RP01715-10UG
20 ug
£181,00
RP01715-20UG
50 ug
£240,00
RP01715-50UG
100 ug
£353,00
RP01715-100UG
500 ug
£1002,00
RP01715-500UG
1000 ug
£1574,00
RP01715-1000UG
Über dieses Produkt
- SKU:
- RP01715
- Zusätzliche Namen:
- FGF21|Fgf8c
- Weitere Details:
- Fibroblast growth factor 21 (FGF21), which stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression. FGF21 has been shown to protect animals from diet-induced obesity when overexpressed in transgenic mice. It also lowers blood glucose and triglyceride levels when administered to diabetic rodents, suggesting it may exhibit the therapeutic characteristics necessary for effective treatment of diabetes. Treatment of animals with FGF21 results in increased energy expenditure, fat utilisation and lipid excretion. FGF21 is most abundantly expressed in the liver, and also expressed in the thymus at lower levels.
- Formulierung:
- Recombinant Mouse FGF-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr30-Ser210) of mouse FGF-21 (Accession #NP_064397.1.) fused with and a
- Immunogen:
- Tyr30-Ser210
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- YPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01715