Recombinant Human FGF-4 Protein
Produktgrößen
10 ug
£145,00
RP01712-10UG
20 ug
£193,00
RP01712-20UG
100 ug
£431,00
RP01712-100UG
500 ug
£1240,00
RP01712-500UG
1000 ug
£1954,00
RP01712-1000UG
Über dieses Produkt
- SKU:
- RP01712
- Zusätzliche Namen:
- FGF-4|FGF4|HBGF-4|HST|HST-1|HSTF-1|HSTF1|K-FGF|KFGF
- Weitere Details:
- FGF (fibroblast growth factor) signalling is known to be required for many aspects of mesoderm formation and patterning during Xenopus development and has been implicated in regulating genes required for the specification of both blood and skeletal muscle lineages. Fibroblast growth factor 4 (FGF4) signaling induces differentiation from embryonic stem cells (ESCs) via the phosphorylation of downstream molecules such as mitogen-activated protein kinase/extracellular signal-related kinase (MEK) and extracellular signal-related kinase 1/2 (ERK1/2). Fibroblast Growth Factor 4 (FGF-4) could not only increase the proliferation of bone marrow mesenchymal stem cells (BMSCs), but also induce BMSCs into hepatocyte-like cells in vitro. FGF4 transduced BMSCs contributed to liver regeneration might by the transplanted microenvironment. The FGF4-bFGF BMSCs thus can enhance the survival of the transplanted cells, diminish myocardial fibrosis, promote myocardial angiogenesis, and improve cardiac functions.
- Formulierung:
- Recombinant Human FGF-4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly25-Leu206) of human FGF-4 (Accession #NP_001998.1) fused with no additional
- Immunogen:
- Gly25-Leu206
- Molekulargewicht:
- 20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01712