Recombinant Human Alpha-synuclein/SNCA Protein
Produktgrößen
10 ug
£107,00
RP01694-10UG
20 ug
£133,00
RP01694-20UG
50 ug
£163,00
RP01694-50UG
100 ug
£240,00
RP01694-100UG
500 ug
£645,00
RP01694-500UG
1000 ug
£1002,00
RP01694-1000UG
Über dieses Produkt
- SKU:
- RP01694
- Zusätzliche Namen:
- NACP|PARK1|PARK4|PD1|SNCA|Syn
- Weitere Details:
- Alpha-Synuclein (alpha-Syn), also known as NACP or SNCA, exists as at least two structural isoforms: one is helix-rich, membrane-bound form that both the N- and C-terminal regions of alpha-synuclein are tightly associated with membranes and the other is disordered, cytosolic form. Synuclein is found predominantly in the presynaptic termini, in both free or membrane-bound forms. SNCA is extensively localized in nucleus of neurons. It has been shown that alpha-Synuclein was highly expressed in the mitochondria in olfactory bulb, hippocampus, striatum, and thalamus, where the cytosolic alpha-Synuclein was also rich.
- Formulierung:
- Recombinant Human Alpha-synuclein/SNCA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala140) of human Alpha-synuclein/SNCA (Accession #NP_000336
- Immunogen:
- Met1-Ala140
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01694