Recombinant Human Erythropoietin/EPO Protein
Produktgrößen
10 ug
£163,00
RP01690-10UG
20 ug
£223,00
RP01690-20UG
50 ug
£336,00
RP01690-50UG
100 ug
£508,00
RP01690-100UG
500 ug
£1478,00
RP01690-500UG
1000 ug
£2335,00
RP01690-1000UG
Über dieses Produkt
- SKU:
- RP01690
- Zusätzliche Namen:
- DBAL|ECYT5|EP|MVCD2; EPO; Erythropoietin
- Weitere Details:
- Erythropoietin (EPO) is the major glycoprotein hormone regulator of mammalian erythropoiesis, and is produced by kidney and liver in an oxygen-dependent manner. The biological effects of EPO are mediated by the specific erythropoietin receptor (EPOR/EPO Receptor) on bone marrow erythroblasts, which transmits signals important for both proliferation and differentiation along the erythroid lineage. EPOR protein is a type a..., single-transmembrane cytokine receptor, and belongs to the homodimerizing subclass which functions as ligand-induced or ligand-stabilized homodimers. EPOR signaling prevents neuronal death and ischemic injury. Recent studies have shown that EPO and EPOR protein may be involved in carcinogenesis, angiogenesis, and invasion.
- Formulierung:
- Recombinant Human Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala28-Arg193) of human Erythropoietin/EPO (Accession #NP_0007
- Immunogen:
- Ala28-Arg193
- Molekulargewicht:
- Approximately 35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01690
