Recombinant Human IL-6 Protein
Produktgrößen
10 ul
£127,00
RP01688-10UL
20 ug
£175,00
RP01688-20UG
50 ul
£240,00
RP01688-50UL
100 ul
£336,00
RP01688-100UL
500 ug
£1002,00
RP01688-500UG
1000 ug
£1574,00
RP01688-1000UG
Über dieses Produkt
- SKU:
- RP01688
- Zusätzliche Namen:
- BSF-2|BSF2|CDF|HGF|HSF|IFN-beta-2|IFNB2|IL-6
- Weitere Details:
- Interleukin-6 is a multifunctional A Alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions.It is secreted by T cells, macrophages , monocytes, fibroblasts,endothelial cells,et.al. to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation.Interleukin 6 has been shown to interact with interleukin-6 receptor and glycoprotein. IL-6 is relevant to many disease processes such as diabetes,atherosclerosis, depression,Alzheimer's Disease,systemic,lupus erythematosus,prostate cancer and rheumatoid arthritis.
- Formulierung:
- Active Recombinant Human IL6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with no add
- Immunogen:
- Val30-Met212
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01688
