Recombinant Human IL-9 Protein
Produktgrößen
10 ug
£145,00
RP01686-10UG
20 ug
£193,00
RP01686-20UG
50 ug
£288,00
RP01686-50UG
100 ug
£431,00
RP01686-100UG
500 ug
£1240,00
RP01686-500UG
1000 ug
£1954,00
RP01686-1000UG
Über dieses Produkt
- SKU:
- RP01686
- Zusätzliche Namen:
- HP40|IL-9; IL9|P40
- Weitere Details:
- Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
- Formulierung:
- Recombinant Human IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ile144) of human IL9 (Accession #NP_000581.1) fused with and a 6xHis
- Immunogen:
- Gln19-Ile144
- Molekulargewicht:
- Approximately 35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01686

