Recombinant Mouse IL-4R alpha/CD124 Protein
Produktgrößen
10 ug
£127,00
RP01680-10UG
20 ug
£175,00
RP01680-20UG
50 ug
£240,00
RP01680-50UG
100 ug
£336,00
RP01680-100UG
500 ug
£1002,00
RP01680-500UG
1000 ug
£1574,00
RP01680-1000UG
Über dieses Produkt
- SKU:
- RP01680
- Zusätzliche Namen:
- CD124; IL-4R|Il4r
- Weitere Details:
- CD124, also known as the interleukin 4 receptor (IL4R), is a typeI transmembrane protein that can regulate IgE antibody production in B cells through binding to interleukin 4 and interleukin 13 and promote differentiation of Th2 cells through binding to interleukin 4. The membrane-bound form of CD124 can be hydrolyzed to a soluble form which can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells.
- Formulierung:
- Recombinant Mouse IL-4R alpha/CD124 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile 26 - Arg 233) of mouse IL4R (Accession #NP_001008700.1) fu
- Immunogen:
- Ile 26 - Arg 233
- Molekulargewicht:
- 35-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01680