Recombinant Mouse LILRB4/ILT-3/CD85k Protein
Produktgrößen
10 ug
£145,00
RP01679-10UG
20 ug
£193,00
RP01679-20UG
50 ug
£288,00
RP01679-50UG
500 ug
£1240,00
RP01679-500UG
1000 ug
£1954,00
RP01679-1000UG
Über dieses Produkt
- SKU:
- RP01679
- Zusätzliche Namen:
- CD85K|gp49|Gp49b|HM18|ILT3|Lilrb4|LIR-5
- Weitere Details:
- LILRB4 (Leukocyte Immunoglobulin Like Receptor B4) is a Protein Coding gene. This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. The receptor can also function in antigen capture and presentation. LILRB4 is believed to down-regulate activation signals mediated by non-receptor tyrosine kinase cascades through the recruitment of SHP-1. LILRB4 is associated with the pathological processes of various inflammatory diseases. The LILRB4 is a central inhibitory receptor in Uterine dendritic cells (uDCs) that plays essential immune-regulatory roles at the maternal-fetal interface.
- Formulierung:
- Recombinant Mouse LILRB4/ILT-3/CD85k Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys238) of mouse LILRB4 (Accession #NP_038560.1) fused
- Immunogen:
- Gly24-Lys238
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01679