Recombinant Mouse IL-15 Protein
Produktgrößen
10 ug
£193,00
RP01676-10UG
20 ug
£258,00
RP01676-20UG
50 ug
£383,00
RP01676-50UG
100 ug
£586,00
RP01676-100UG
500 ug
£1716,00
RP01676-500UG
1000 ug
£2716,00
RP01676-1000UG
Über dieses Produkt
- SKU:
- RP01676
- Zusätzliche Namen:
- Il15, Interleukin-15, IL-15
- Weitere Details:
- Interleukin 15 (IL-15 ) is a cytokine that regulates T and natural killer cell activation and proliferation. IL-15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. In mouse, studies suggest that IL-15 may increase the expression of apoptosis inhibitor Bcl-xL, possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules.
- Formulierung:
- Recombinant Mouse IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of mouse IL-15 (Accession #NP_001241676.1) fused with and a 6xHis
- Immunogen:
- Asn49-Ser162
- Molekulargewicht:
- 14 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01676
