Recombinant Mouse B7-DC/PD-L2/CD273 Protein
Produktgrößen
10 ug
£127,00
RP01666-10UG
20 ug
£157,00
RP01666-20UG
50 ug
£223,00
RP01666-50UG
100 ug
£336,00
RP01666-100UG
500 ug
£937,00
RP01666-500UG
1000 ug
£1478,00
RP01666-1000UG
Über dieses Produkt
- SKU:
- RP01666
- Zusätzliche Namen:
- B7-DC|Btdc|F730015O22Rik; PDCD1LG2; CD273|PD-L2
- Weitere Details:
- Programmed Death Ligand 2 (PD-L2), also known as B7-DC and butyrophilin-like protein, is a member of the B7 family of proteins that provide signals for regulating T-cell activation and tolerance .PD-L2 is expressed on dendritic cells, subsets of activated CD4+ and CD8+ T cells, and memory B cells that differentiate into plasma cells. At inflammatory sites such as rheumatoid arthritis, allergen exposure, and virus infection, PD-L2 is up-regulated on synoviocytes, infiltrating macrophages, dendritic cells, and airway epithelial cells. PD-L2, along with B7-H1/PD-L1, binds to T cell PD-1 where it promotes IFN-gamma production and CD40 Ligand up-regulation while inhibiting IL-4 production. In addition, PD-L2 binds to RGM-B on macrophages and alveolar epithelial cells, supporting respiratory immune tolerance. In asthma, PD-L2 suppresses IL-5 and IL-13 production, promotes IL-12 production by dendritic cells, and supports allergen-induced airway hyper-responsiveness and mucus production.
- Formulierung:
- Recombinant Mouse B7-DC/PD-L2/CD273 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse B7-DC/PD-L2/CD273 (Accession #NP_067371
- Immunogen:
- Leu20-Arg219
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01666
